SlideShare a Scribd company logo
*




    CouchDB
No SQL? No Driver?
   No problem.
      Angel Pizarro
    angel@upenn.edu


                      * www.bauwel-movement.co.uk/ sculpture.php
About Me
Me: CBIL alumni! Work in mass spec
proteomics
Lots of data in lots of formats in
bioinformatics
Ruby for programming and Ruby on Rails for
Web apps
 But that doesn’t matter for CouchDB!
Interested in CouchDB for AWS deployment
Overview
Talk about Key-Value stores
Introduce some general theory and
concepts
CouchDB specifics
Example problem
More CouchDB specifics
Questions?
Key-Value Databases
Datastore of values indexed
by keys (duh!)
Hash or B-Tree index for
keys
                                  Cassandra
  Hash is FAST, but only allows
  single-value lookups
  B-Tree is slower, but allows
  range queries
Horizontally scalable - via key
partitioning
The CAP theory : applies when business
     logic is separate from storage

Consistency vs. Availability
vs. Partition tolerance
RDBMS = enforced
consistency
PAXOS = quorum
consistency
CouchDB (and others) =
eventual consistency
and horizontally
scalable


  http://www.julianbrowne.com/article/viewer/brewers-cap-theorem
CouchDB
CouchDB
Document Oriented Database
 JSON documents
CouchDB
Document Oriented Database
 JSON documents
HTTP protocol using REST operations
 No direct native language drivers *
 Javascript is the lingua franca




                       * Hovercraft: http://github.com/jchris/hovercraft/
CouchDB
Document Oriented Database
 JSON documents
HTTP protocol using REST operations
 No direct native language drivers *
 Javascript is the lingua franca
ACID & MVCC guarantees on a per-
document basis



                       * Hovercraft: http://github.com/jchris/hovercraft/
CouchDB
Document Oriented Database
 JSON documents
HTTP protocol using REST operations
 No direct native language drivers *
 Javascript is the lingua franca
ACID & MVCC guarantees on a per-
document basis
Map-Reduce indexing and views


                       * Hovercraft: http://github.com/jchris/hovercraft/
CouchDB
Document Oriented Database
 JSON documents
HTTP protocol using REST operations
 No direct native language drivers *
 Javascript is the lingua franca
ACID & MVCC guarantees on a per-
document basis
Map-Reduce indexing and views
Back-ups and replication are easy-peasy
                       * Hovercraft: http://github.com/jchris/hovercraft/
Javascript Object
    Notation
Javascript Object
    Notation            *




               * http://www.json.org
Example JSON

{
    “name”: “J. Doe”,
    “friends”: 0,
      “traits”: [“nice”, “outgoing”]
}
REST
REST
Representational State Transfer
REST
Representational State Transfer
Clients-Server separation with uniform interface
(HTTP)
REST
Representational State Transfer
Clients-Server separation with uniform interface
(HTTP)
  Load-balancing, caching, authorization & authentication,
  proxies
REST
Representational State Transfer
Clients-Server separation with uniform interface
(HTTP)
  Load-balancing, caching, authorization & authentication,
  proxies
Stateless - client is responsible for creating a self-
sufficient request
REST
Representational State Transfer
Clients-Server separation with uniform interface
(HTTP)
  Load-balancing, caching, authorization & authentication,
  proxies
Stateless - client is responsible for creating a self-
sufficient request
Resources are cacheable - servers must mark
non-cacheable resources as such
REST
Representational State Transfer
Clients-Server separation with uniform interface
(HTTP)
  Load-balancing, caching, authorization & authentication,
  proxies
Stateless - client is responsible for creating a self-
sufficient request
Resources are cacheable - servers must mark
non-cacheable resources as such
Only 5 HTTP verbs
REST
Representational State Transfer
Clients-Server separation with uniform interface
(HTTP)
  Load-balancing, caching, authorization & authentication,
  proxies
Stateless - client is responsible for creating a self-
sufficient request
Resources are cacheable - servers must mark
non-cacheable resources as such
Only 5 HTTP verbs
 GET, PUT, POST, DELETE, HEAD
CouchDB
 REST/CRUD
 GET          read


 PUT     create or update


DELETE   delete something


POST     bulk operations
CouchDB passes the
    ACID test
Each document is completely self-sufficient
Each document has a version number
An update operation writes a complete
new copy of the the record and is assigned
the new version number
Append-only file structure allows the write
to occur while still serving read requests
MVCC                    RDBMS   CouchDB
Multi-Version
Concurrency Control
RDBMS enforces consistency
using read/write locks
Instead of locks, CouchDB
just serve up old data
Multi-document (mutli-row)
transactional semantics
must be handled by the
application
Database API
Create a DB:

$ curl -X PUT http://127.0.0.1:5984/friendbook
{"ok":true}
Database API
Create a DB:
       Protocol

$ curl -X PUT http://127.0.0.1:5984/friendbook
{"ok":true}
Database API
Create a DB:
                   CouchDB server

$ curl -X PUT http://127.0.0.1:5984/friendbook
{"ok":true}
Database API
Create a DB:
                                        DB name

$ curl -X PUT http://127.0.0.1:5984/friendbook
{"ok":true}
Database API
Create a DB:

$ curl -X PUT http://127.0.0.1:5984/friendbook
{"ok":true}

Try it Again: {"error":"db_exists"}
Database API
Create a DB:

$ curl -X PUT http://127.0.0.1:5984/friendbook
{"ok":true}

Try it Again: {"error":"db_exists"}
                                      Not recoverable!
Delete a DB:
 $ curl -X DELETE http://localhost:5984/friendbook
 {"ok":true}
Inserting a document
All insert require that you give a unique ID. You can
request one from CouchDB:
$ curl -X GET http://localhost:5984/_uuids
{"uuids":["d1dde0996a4db7c1ebc78fb89c01b9e6"]}
Inserting a document
  All insert require that you give a unique ID. You can
  request one from CouchDB:
  $ curl -X GET http://localhost:5984/_uuids
  {"uuids":["d1dde0996a4db7c1ebc78fb89c01b9e6"]}


We’ll just give one:
$ curl -X PUT http://localhost:5984/friendbook/j_doe 
   -d @j_doe.json

{"ok":true,
"id":"j_doe",
"rev":"1-062af1c4ac73287b7e07396c86243432"}
Inserting a document
  All insert require that you give a unique ID. You can
  request one from CouchDB:
  $ curl -X GET http://localhost:5984/_uuids
  {"uuids":["d1dde0996a4db7c1ebc78fb89c01b9e6"]}


We’ll just give one:
$ curl -X PUT http://localhost:5984/friendbook/j_doe 
   -d @j_doe.json
                                  Read a JSON file
{"ok":true,
"id":"j_doe",
"rev":"1-062af1c4ac73287b7e07396c86243432"}
Full JSON document
Before
{ "name": "J. Doe",
 "friends": 0 }


After
{   "_id":       "j_doe",
    "_rev":      "1-062af1c4ac73287b7e07396c86243432",
    "name":      "J. Doe",
    "friends":   0 }
Updating a document
$ curl -X PUT http://localhost:5984/friendbook/j_doe 
      -d '{"name": "J. Doe", "friends": 1 }'
{"error":"conflict","reason":"Document update conflict."}
Updating a document
$ curl -X PUT http://localhost:5984/friendbook/j_doe 
      -d '{"name": "J. Doe", "friends": 1 }'
{"error":"conflict","reason":"Document update conflict."}

        Must give _rev (revision number) for updates!
                                  revised.json
           { "_rev":"1-062af1c4ac73287b7e07396c86243432",
             "name":"J. Doe", "friends": 1 }


$ curl -X PUT http://localhost:5984/friendbook/j_doe -d @revised.json

{"ok":true,"id":"j_doe","rev":"2-0629239b53a8d146a3a3c4c63e
2dbfd0"}
Deleting a document
$ curl -X DELETE http://localhost:5984/friendbook/j_doe
{"error":"conflict","reason":"Document update conflict."}

        Must give revision number for deletes!
$ curl -X DELETE http://localhost:5984/friendbook/j_doe?
rev=2-0629239b53a8d146a3a3c4c63e2dbfd0
{"ok":true,"id":"j_doe",
 "rev":"3-57673a4b7b662bb916cc374a92318c6b"}

    Returns a revision number for the delete
$ curl -X GET http://localhost:5984/friendbook/j_doe
{"error":"not_found","reason":"deleted"}
Bulk operation
            POST /database/_bulk_docs with a
            JSON document containing all of the new
            or updated documents.
// documents to bulk upload
{
  "docs": [
    {"_id": "0", "integer": 0, "string":   "0"},
    {"_id": "1", "integer": 1, "string":   "1"},
    {"_id": "2", "integer": 2, "string":   "2"}
  ]
                                           // reply from CouchDB
}
                                           [
                                              {"id":"0","rev":"1-62657917"},
                                              {"id":"1","rev":"1-2089673485"},
                                              {"id":"2","rev":"1-2063452834"}
                                           ]
GOTCHA’s!
Version storage is not guaranteed!
 Do not use this as a VCS!
 POST to /db/_compact deletes all older vesions
To “roll back a transaction” you must:
 Retrieve all related records, cache these
 Insert any updates to records.
 On failure, use the returned revision numbers to
 re-insert the older record as a new one
Our Example Problem
Our Example Problem
 Hello world? Blog? Twitter clone?
Our Example Problem
 Hello world? Blog? Twitter clone?
 Let’s store all human proteins instead
Our Example Problem
               Hello world? Blog? Twitter clone?
               Let’s store all human proteins instead

LOCUS     YP_003024029           227 aa         linear PRI 09-JUL-2009
DEFINITION cytochrome c oxidase subunit II [Homo sapiens].
ACCESSION YP_003024029
VERSION    YP_003024029.1 GI:251831110
DBLINK    Project:30353
DBSOURCE REFSEQ: accession NC_012920.1
KEYWORDS .
SOURCE     mitochondrion Homo sapiens (human)
 ORGANISM Homo sapiens
       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
       Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
       Catarrhini; Hominidae; Homo.
Our Example Problem
              Hello world? Blog? Twitter clone?
              Let’s store all human proteins instead

LOCUS     YP_003024029           227 aa         linear PRI 09-JUL-2009
DEFINITION cytochrome c oxidase subunit II [Homo sapiens].
ACCESSION YP_003024029
VERSION    YP_003024029.1 GI:251831110
DBLINK    Project:30353
                      FEATURES
DBSOURCE REFSEQ: accession NC_012920.1  Location/Qualifiers
KEYWORDS .               source       1..227
SOURCE                             /organism="Homo sapiens"
           mitochondrion Homo sapiens (human)
 ORGANISM Homo sapiens             /organelle="mitochondrion"
                                   /isolation_source="caucasian"
       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
                                   /db_xref="taxon:9606"
       Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
       Catarrhini; Hominidae; Homo./tissue_type="placenta"
                                   /country="United Kingdom: Great Britain"
                                   /note="this is the rCRS"
                         Protein      1..227
                                   /product="cytochrome c oxidase subunit II"
                                   /calculated_mol_wt=25434
                                                                         http://www.ncbi.nlm.nih.gov/
Our Example Problem
              Hello world? Blog? Twitter clone?
              Let’s store all human proteins instead

LOCUS     YP_003024029           227 aa         linear PRI 09-JUL-2009
DEFINITION cytochrome c oxidase subunit II [Homo sapiens].
ACCESSION YP_003024029
VERSION    YP_003024029.1 GI:251831110
DBLINK    Project:30353
                      FEATURES
DBSOURCE REFSEQ: accession NC_012920.1  Location/Qualifiers
KEYWORDS .               source       1..227
SOURCE                             /organism="Homo sapiens"
           mitochondrion Homo sapiens (human)
 ORGANISM Homo sapiens             /organelle="mitochondrion"
                                   /isolation_source="caucasian"
       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
                                   /db_xref="taxon:9606"
       Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
       Catarrhini; Hominidae; Homo./tissue_type="placenta"
                                   /country="United Kingdom: Great Britain"
                                   /note="this is the rCRS"
                         Protein      1..227
                                   /product="cytochrome c oxidase subunit II"
                                   /calculated_mol_wt=25434
                                                                         http://www.ncbi.nlm.nih.gov/
Futon : A Couchapp
Futon : A Couchapp
Futon : A Couchapp
Futon : A Couchapp


          This one is
          going to be
         a bit tougher
Design Documents
Design Documents
The key to using CouchDB as more than a
key-value store
Design Documents
The key to using CouchDB as more than a
key-value store
Just another JSON document, but contain
javascript functions that CouchDB treats
as application code
 Functions are executed within CouchDB
Design Documents
The key to using CouchDB as more than a
key-value store
Just another JSON document, but contain
javascript functions that CouchDB treats
as application code
 Functions are executed within CouchDB
Contain sections for map-reduce views,
data validation, alternate formatting, ...
 Also library code & data structures specific to
 the design document
Soy Map!
Soy Map!
Views use a Map-Reduce model for
indexing and defining “virtual” documents
 Fits well with assumptions of self-sufficient
 documents and eventual consistency
Soy Map!
Views use a Map-Reduce model for
indexing and defining “virtual” documents
 Fits well with assumptions of self-sufficient
 documents and eventual consistency
Map function is applied to all documents in
the database
 Emits (parts of) documents that pass mustard
 Indexing is incremental after an initial definition
 You can choose to defer an index update for
 insert speed
Map function example
Map function example
Complex Map
Complex Map
View Result
View Result
GET by the indexed key
GET by the indexed key

  GET /refseq_human/_design/gb/_view/dbXref?key="GeneID:10"

{"total_rows":7,"offset":2,"rows":[
   {"id":"NP_000006",
    "key":"GeneID:10",
    "value":"NP_000006"}
]}
Reduce functions
Optional and used in concert with a
specific map function
Great for summarizing or collating
numerical data points
 E.g. counts, number of over time X, average
 load, probability of conversion
Not really applicable to our example, so
we’ll not cover it today
Show me the ... HTML?
 JSON is great, but what about, ya know,
 something useful?
 You can make a separate app to reformat
 the JSON
 OR you can use the “shows” section of a
 _design document.
  Rich formating possible with functions,
  templates, and special include macros
FASTA format
“shows” : {
  “fasta” : “function(doc, req) {
           return ‘>’ +
                       doc._id +
                       ‘n’ +
                       doc.seq;
         }”,
...
FASTA format
“shows” : {
  “fasta” : “function(doc, req) {
           return ‘>’ +
                       doc._id +
                       ‘n’ +
                       doc.seq;
         }”,
...

     GET /refseq_human/_design/gb/_show/fasta/NP_000006
  >NP_000006
  MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRR
  NRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIV
  DAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPK
  KKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKD
  NTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI
Backups & Replication
Backups & Replication
Backup: simply copy the database file
Backups & Replication
Backup: simply copy the database file
Replicate: send a POST request with a source and
target database
Backups & Replication
Backup: simply copy the database file
Replicate: send a POST request with a source and
target database
   Source and target DB’s can either be local (just
   the db name) or remote (full URL)
Backups & Replication
Backup: simply copy the database file
Replicate: send a POST request with a source and
target database
   Source and target DB’s can either be local (just
   the db name) or remote (full URL)
   “continous”: true option will register the
   target to the source’s _changes notification API
Backups & Replication
     Backup: simply copy the database file
     Replicate: send a POST request with a source and
     target database
        Source and target DB’s can either be local (just
        the db name) or remote (full URL)
        “continous”: true option will register the
        target to the source’s _changes notification API

$ curl -X POST http://localhost:5984/_replicate 
 -d '{"source":"db", "target":"db-replica", "continuous":true}'
Data normalization? Schema?
   Foreign Keys? Column
        Constraints?
Data normalization? Schema?
   Foreign Keys? Column
        Constraints?
 forgetaboutit
  Italian for “forget about it”
  … “or die”
Data normalization? Schema?
   Foreign Keys? Column
        Constraints?
 forgetaboutit
  Italian for “forget about it”
  … “or die”
 Denormalize “until it hurts”
Data normalization? Schema?
   Foreign Keys? Column
        Constraints?
 forgetaboutit
  Italian for “forget about it”
  … “or die”
 Denormalize “until it hurts”
 But there are validations are available
Data normalization? Schema?
   Foreign Keys? Column
        Constraints?
 forgetaboutit
  Italian for “forget about it”
  … “or die”
 Denormalize “until it hurts”
 But there are validations are available
  Validates a record on update with a JS function
Required Fields
function(newDoc, oldDoc, userCtx) {
 function require(field, message) {
   message = message || "Document must have a " + field;
   if (!newDoc[field]) throw({forbidden : message});
 };

    if (newDoc.type == "blogPost") {
      require("title");
      require("created_at");
      require("body");
                                       Convention alert!
      require("author");
    } ...
}
Thank You!
Learn
http://couchdb.apache.org/
http://books.couchdb.org/relax
http://wiki.apache.org/couchdb/

Awesome posts by community
http://planet.couchdb.org

Development Libraries
http://github.com/jchris/couchrest
http://github.com/couchapp/couchapp

More Related Content

Couchdb: No SQL? No driver? No problem

  • 1. * CouchDB No SQL? No Driver? No problem. Angel Pizarro angel@upenn.edu * www.bauwel-movement.co.uk/ sculpture.php
  • 2. About Me Me: CBIL alumni! Work in mass spec proteomics Lots of data in lots of formats in bioinformatics Ruby for programming and Ruby on Rails for Web apps But that doesn’t matter for CouchDB! Interested in CouchDB for AWS deployment
  • 3. Overview Talk about Key-Value stores Introduce some general theory and concepts CouchDB specifics Example problem More CouchDB specifics Questions?
  • 4. Key-Value Databases Datastore of values indexed by keys (duh!) Hash or B-Tree index for keys Cassandra Hash is FAST, but only allows single-value lookups B-Tree is slower, but allows range queries Horizontally scalable - via key partitioning
  • 5. The CAP theory : applies when business logic is separate from storage Consistency vs. Availability vs. Partition tolerance RDBMS = enforced consistency PAXOS = quorum consistency CouchDB (and others) = eventual consistency and horizontally scalable http://www.julianbrowne.com/article/viewer/brewers-cap-theorem
  • 8. CouchDB Document Oriented Database JSON documents HTTP protocol using REST operations No direct native language drivers * Javascript is the lingua franca * Hovercraft: http://github.com/jchris/hovercraft/
  • 9. CouchDB Document Oriented Database JSON documents HTTP protocol using REST operations No direct native language drivers * Javascript is the lingua franca ACID & MVCC guarantees on a per- document basis * Hovercraft: http://github.com/jchris/hovercraft/
  • 10. CouchDB Document Oriented Database JSON documents HTTP protocol using REST operations No direct native language drivers * Javascript is the lingua franca ACID & MVCC guarantees on a per- document basis Map-Reduce indexing and views * Hovercraft: http://github.com/jchris/hovercraft/
  • 11. CouchDB Document Oriented Database JSON documents HTTP protocol using REST operations No direct native language drivers * Javascript is the lingua franca ACID & MVCC guarantees on a per- document basis Map-Reduce indexing and views Back-ups and replication are easy-peasy * Hovercraft: http://github.com/jchris/hovercraft/
  • 12. Javascript Object Notation
  • 13. Javascript Object Notation * * http://www.json.org
  • 14. Example JSON { “name”: “J. Doe”, “friends”: 0, “traits”: [“nice”, “outgoing”] }
  • 15. REST
  • 17. REST Representational State Transfer Clients-Server separation with uniform interface (HTTP)
  • 18. REST Representational State Transfer Clients-Server separation with uniform interface (HTTP) Load-balancing, caching, authorization & authentication, proxies
  • 19. REST Representational State Transfer Clients-Server separation with uniform interface (HTTP) Load-balancing, caching, authorization & authentication, proxies Stateless - client is responsible for creating a self- sufficient request
  • 20. REST Representational State Transfer Clients-Server separation with uniform interface (HTTP) Load-balancing, caching, authorization & authentication, proxies Stateless - client is responsible for creating a self- sufficient request Resources are cacheable - servers must mark non-cacheable resources as such
  • 21. REST Representational State Transfer Clients-Server separation with uniform interface (HTTP) Load-balancing, caching, authorization & authentication, proxies Stateless - client is responsible for creating a self- sufficient request Resources are cacheable - servers must mark non-cacheable resources as such Only 5 HTTP verbs
  • 22. REST Representational State Transfer Clients-Server separation with uniform interface (HTTP) Load-balancing, caching, authorization & authentication, proxies Stateless - client is responsible for creating a self- sufficient request Resources are cacheable - servers must mark non-cacheable resources as such Only 5 HTTP verbs GET, PUT, POST, DELETE, HEAD
  • 23. CouchDB REST/CRUD GET read PUT create or update DELETE delete something POST bulk operations
  • 24. CouchDB passes the ACID test Each document is completely self-sufficient Each document has a version number An update operation writes a complete new copy of the the record and is assigned the new version number Append-only file structure allows the write to occur while still serving read requests
  • 25. MVCC RDBMS CouchDB Multi-Version Concurrency Control RDBMS enforces consistency using read/write locks Instead of locks, CouchDB just serve up old data Multi-document (mutli-row) transactional semantics must be handled by the application
  • 26. Database API Create a DB: $ curl -X PUT http://127.0.0.1:5984/friendbook {"ok":true}
  • 27. Database API Create a DB: Protocol $ curl -X PUT http://127.0.0.1:5984/friendbook {"ok":true}
  • 28. Database API Create a DB: CouchDB server $ curl -X PUT http://127.0.0.1:5984/friendbook {"ok":true}
  • 29. Database API Create a DB: DB name $ curl -X PUT http://127.0.0.1:5984/friendbook {"ok":true}
  • 30. Database API Create a DB: $ curl -X PUT http://127.0.0.1:5984/friendbook {"ok":true} Try it Again: {"error":"db_exists"}
  • 31. Database API Create a DB: $ curl -X PUT http://127.0.0.1:5984/friendbook {"ok":true} Try it Again: {"error":"db_exists"} Not recoverable! Delete a DB: $ curl -X DELETE http://localhost:5984/friendbook {"ok":true}
  • 32. Inserting a document All insert require that you give a unique ID. You can request one from CouchDB: $ curl -X GET http://localhost:5984/_uuids {"uuids":["d1dde0996a4db7c1ebc78fb89c01b9e6"]}
  • 33. Inserting a document All insert require that you give a unique ID. You can request one from CouchDB: $ curl -X GET http://localhost:5984/_uuids {"uuids":["d1dde0996a4db7c1ebc78fb89c01b9e6"]} We’ll just give one: $ curl -X PUT http://localhost:5984/friendbook/j_doe -d @j_doe.json {"ok":true, "id":"j_doe", "rev":"1-062af1c4ac73287b7e07396c86243432"}
  • 34. Inserting a document All insert require that you give a unique ID. You can request one from CouchDB: $ curl -X GET http://localhost:5984/_uuids {"uuids":["d1dde0996a4db7c1ebc78fb89c01b9e6"]} We’ll just give one: $ curl -X PUT http://localhost:5984/friendbook/j_doe -d @j_doe.json Read a JSON file {"ok":true, "id":"j_doe", "rev":"1-062af1c4ac73287b7e07396c86243432"}
  • 35. Full JSON document Before { "name": "J. Doe", "friends": 0 } After { "_id": "j_doe", "_rev": "1-062af1c4ac73287b7e07396c86243432", "name": "J. Doe", "friends": 0 }
  • 36. Updating a document $ curl -X PUT http://localhost:5984/friendbook/j_doe -d '{"name": "J. Doe", "friends": 1 }' {"error":"conflict","reason":"Document update conflict."}
  • 37. Updating a document $ curl -X PUT http://localhost:5984/friendbook/j_doe -d '{"name": "J. Doe", "friends": 1 }' {"error":"conflict","reason":"Document update conflict."} Must give _rev (revision number) for updates! revised.json { "_rev":"1-062af1c4ac73287b7e07396c86243432", "name":"J. Doe", "friends": 1 } $ curl -X PUT http://localhost:5984/friendbook/j_doe -d @revised.json {"ok":true,"id":"j_doe","rev":"2-0629239b53a8d146a3a3c4c63e 2dbfd0"}
  • 38. Deleting a document $ curl -X DELETE http://localhost:5984/friendbook/j_doe {"error":"conflict","reason":"Document update conflict."} Must give revision number for deletes! $ curl -X DELETE http://localhost:5984/friendbook/j_doe? rev=2-0629239b53a8d146a3a3c4c63e2dbfd0 {"ok":true,"id":"j_doe", "rev":"3-57673a4b7b662bb916cc374a92318c6b"} Returns a revision number for the delete $ curl -X GET http://localhost:5984/friendbook/j_doe {"error":"not_found","reason":"deleted"}
  • 39. Bulk operation POST /database/_bulk_docs with a JSON document containing all of the new or updated documents. // documents to bulk upload { "docs": [ {"_id": "0", "integer": 0, "string": "0"}, {"_id": "1", "integer": 1, "string": "1"}, {"_id": "2", "integer": 2, "string": "2"} ] // reply from CouchDB } [ {"id":"0","rev":"1-62657917"}, {"id":"1","rev":"1-2089673485"}, {"id":"2","rev":"1-2063452834"} ]
  • 40. GOTCHA’s! Version storage is not guaranteed! Do not use this as a VCS! POST to /db/_compact deletes all older vesions To “roll back a transaction” you must: Retrieve all related records, cache these Insert any updates to records. On failure, use the returned revision numbers to re-insert the older record as a new one
  • 42. Our Example Problem Hello world? Blog? Twitter clone?
  • 43. Our Example Problem Hello world? Blog? Twitter clone? Let’s store all human proteins instead
  • 44. Our Example Problem Hello world? Blog? Twitter clone? Let’s store all human proteins instead LOCUS YP_003024029 227 aa linear PRI 09-JUL-2009 DEFINITION cytochrome c oxidase subunit II [Homo sapiens]. ACCESSION YP_003024029 VERSION YP_003024029.1 GI:251831110 DBLINK Project:30353 DBSOURCE REFSEQ: accession NC_012920.1 KEYWORDS . SOURCE mitochondrion Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo.
  • 45. Our Example Problem Hello world? Blog? Twitter clone? Let’s store all human proteins instead LOCUS YP_003024029 227 aa linear PRI 09-JUL-2009 DEFINITION cytochrome c oxidase subunit II [Homo sapiens]. ACCESSION YP_003024029 VERSION YP_003024029.1 GI:251831110 DBLINK Project:30353 FEATURES DBSOURCE REFSEQ: accession NC_012920.1 Location/Qualifiers KEYWORDS . source 1..227 SOURCE /organism="Homo sapiens" mitochondrion Homo sapiens (human) ORGANISM Homo sapiens /organelle="mitochondrion" /isolation_source="caucasian" Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; /db_xref="taxon:9606" Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo./tissue_type="placenta" /country="United Kingdom: Great Britain" /note="this is the rCRS" Protein 1..227 /product="cytochrome c oxidase subunit II" /calculated_mol_wt=25434 http://www.ncbi.nlm.nih.gov/
  • 46. Our Example Problem Hello world? Blog? Twitter clone? Let’s store all human proteins instead LOCUS YP_003024029 227 aa linear PRI 09-JUL-2009 DEFINITION cytochrome c oxidase subunit II [Homo sapiens]. ACCESSION YP_003024029 VERSION YP_003024029.1 GI:251831110 DBLINK Project:30353 FEATURES DBSOURCE REFSEQ: accession NC_012920.1 Location/Qualifiers KEYWORDS . source 1..227 SOURCE /organism="Homo sapiens" mitochondrion Homo sapiens (human) ORGANISM Homo sapiens /organelle="mitochondrion" /isolation_source="caucasian" Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; /db_xref="taxon:9606" Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo./tissue_type="placenta" /country="United Kingdom: Great Britain" /note="this is the rCRS" Protein 1..227 /product="cytochrome c oxidase subunit II" /calculated_mol_wt=25434 http://www.ncbi.nlm.nih.gov/
  • 47. Futon : A Couchapp
  • 48. Futon : A Couchapp
  • 49. Futon : A Couchapp
  • 50. Futon : A Couchapp This one is going to be a bit tougher
  • 52. Design Documents The key to using CouchDB as more than a key-value store
  • 53. Design Documents The key to using CouchDB as more than a key-value store Just another JSON document, but contain javascript functions that CouchDB treats as application code Functions are executed within CouchDB
  • 54. Design Documents The key to using CouchDB as more than a key-value store Just another JSON document, but contain javascript functions that CouchDB treats as application code Functions are executed within CouchDB Contain sections for map-reduce views, data validation, alternate formatting, ... Also library code & data structures specific to the design document
  • 56. Soy Map! Views use a Map-Reduce model for indexing and defining “virtual” documents Fits well with assumptions of self-sufficient documents and eventual consistency
  • 57. Soy Map! Views use a Map-Reduce model for indexing and defining “virtual” documents Fits well with assumptions of self-sufficient documents and eventual consistency Map function is applied to all documents in the database Emits (parts of) documents that pass mustard Indexing is incremental after an initial definition You can choose to defer an index update for insert speed
  • 64. GET by the indexed key
  • 65. GET by the indexed key GET /refseq_human/_design/gb/_view/dbXref?key="GeneID:10" {"total_rows":7,"offset":2,"rows":[ {"id":"NP_000006", "key":"GeneID:10", "value":"NP_000006"} ]}
  • 66. Reduce functions Optional and used in concert with a specific map function Great for summarizing or collating numerical data points E.g. counts, number of over time X, average load, probability of conversion Not really applicable to our example, so we’ll not cover it today
  • 67. Show me the ... HTML? JSON is great, but what about, ya know, something useful? You can make a separate app to reformat the JSON OR you can use the “shows” section of a _design document. Rich formating possible with functions, templates, and special include macros
  • 68. FASTA format “shows” : { “fasta” : “function(doc, req) { return ‘>’ + doc._id + ‘n’ + doc.seq; }”, ...
  • 69. FASTA format “shows” : { “fasta” : “function(doc, req) { return ‘>’ + doc._id + ‘n’ + doc.seq; }”, ... GET /refseq_human/_design/gb/_show/fasta/NP_000006 >NP_000006 MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRR NRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIV DAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPK KKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKD NTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI
  • 71. Backups & Replication Backup: simply copy the database file
  • 72. Backups & Replication Backup: simply copy the database file Replicate: send a POST request with a source and target database
  • 73. Backups & Replication Backup: simply copy the database file Replicate: send a POST request with a source and target database Source and target DB’s can either be local (just the db name) or remote (full URL)
  • 74. Backups & Replication Backup: simply copy the database file Replicate: send a POST request with a source and target database Source and target DB’s can either be local (just the db name) or remote (full URL) “continous”: true option will register the target to the source’s _changes notification API
  • 75. Backups & Replication Backup: simply copy the database file Replicate: send a POST request with a source and target database Source and target DB’s can either be local (just the db name) or remote (full URL) “continous”: true option will register the target to the source’s _changes notification API $ curl -X POST http://localhost:5984/_replicate -d '{"source":"db", "target":"db-replica", "continuous":true}'
  • 76. Data normalization? Schema? Foreign Keys? Column Constraints?
  • 77. Data normalization? Schema? Foreign Keys? Column Constraints? forgetaboutit Italian for “forget about it” … “or die”
  • 78. Data normalization? Schema? Foreign Keys? Column Constraints? forgetaboutit Italian for “forget about it” … “or die” Denormalize “until it hurts”
  • 79. Data normalization? Schema? Foreign Keys? Column Constraints? forgetaboutit Italian for “forget about it” … “or die” Denormalize “until it hurts” But there are validations are available
  • 80. Data normalization? Schema? Foreign Keys? Column Constraints? forgetaboutit Italian for “forget about it” … “or die” Denormalize “until it hurts” But there are validations are available Validates a record on update with a JS function
  • 81. Required Fields function(newDoc, oldDoc, userCtx) { function require(field, message) { message = message || "Document must have a " + field; if (!newDoc[field]) throw({forbidden : message}); }; if (newDoc.type == "blogPost") { require("title"); require("created_at"); require("body"); Convention alert! require("author"); } ... }
  • 82. Thank You! Learn http://couchdb.apache.org/ http://books.couchdb.org/relax http://wiki.apache.org/couchdb/ Awesome posts by community http://planet.couchdb.org Development Libraries http://github.com/jchris/couchrest http://github.com/couchapp/couchapp

Editor's Notes

  1. - If the key is a DateTime, then B-tree is a much better choice
  2. Brewer’s CAP Theorem http://www.julianbrowne.com/article/viewer/brewers-cap-theorem Partition tolerance encompasses both business logic and data partitioning. PAXOS will override more recent updates to a disconnected resource if it did not vote on a previous transaction.
  3. Highlighted words covered later in order that they appear
  4. Highlighted words covered later in order that they appear
  5. Highlighted words covered later in order that they appear
  6. Highlighted words covered later in order that they appear
  7. Highlighted words covered later in order that they appear
  8. Highlighted words covered later in order that they appear
  9. Other stuff, but this is the most relevant for the discussion Older browsers only support green verbs
  10. Other stuff, but this is the most relevant for the discussion Older browsers only support green verbs
  11. Other stuff, but this is the most relevant for the discussion Older browsers only support green verbs
  12. Other stuff, but this is the most relevant for the discussion Older browsers only support green verbs
  13. Other stuff, but this is the most relevant for the discussion Older browsers only support green verbs
  14. Other stuff, but this is the most relevant for the discussion Older browsers only support green verbs
  15. Other stuff, but this is the most relevant for the discussion Older browsers only support green verbs
  16. CRUD = Create Read Update Delete
  17. Next is the API discussions
  18. You can give a “count” parameter to UUID function: $ curl -X GET http://localhost:5984/_uuids?count=10
  19. You can give a “count” parameter to UUID function: $ curl -X GET http://localhost:5984/_uuids?count=10
  20. Can give it as an URL parameter or in the E-Tag HTTP header. You cannot delete a specific revision! The revision number is only there so that the server can definitively say you are talking about the most recent record. You need delete rev for replication of delete operations on other servers that are being synced to this one.
  21. Might also be able to delete a particualr version. Will have to check that.
  22. Note: I could’ve made GI a number, but did not in this case Zipcodes would be a bad thing to turn into numbers, b/c of possible leading zeros
  23. Note: I could’ve made GI a number, but did not in this case Zipcodes would be a bad thing to turn into numbers, b/c of possible leading zeros
  24. Note: I could’ve made GI a number, but did not in this case Zipcodes would be a bad thing to turn into numbers, b/c of possible leading zeros
  25. Best practice = One design document per application or set of requirements Next: Map-Reduce Views
  26. Best practice = One design document per application or set of requirements Next: Map-Reduce Views
  27. Best practice = One design document per application or set of requirements Next: Map-Reduce Views
  28. We are just going to take a look at a simple plain text example of FASTA file
  29. Append-only file structure ensures that your DB is always valid, even during mid-write server failures.
  30. Append-only file structure ensures that your DB is always valid, even during mid-write server failures.
  31. Append-only file structure ensures that your DB is always valid, even during mid-write server failures.
  32. Append-only file structure ensures that your DB is always valid, even during mid-write server failures.
  33. Append-only file structure ensures that your DB is always valid, even during mid-write server failures.